ENJOY NEW MONTHLY DISCOUNTS ON SELECTED BOCOUTURE, JUVEDERM, RESTYLANE & MORE

MON - FRI 10:00 AM - 06:00 PM EST.
SAT - SUN holiday

Free line: +1 888 866 0201
Text messages: +1 647 696 5424
The product images shown are for illustration purposes only and may not be an exact representation of the product
Novera GHRP-6 5mg
RESEARCH USE ONLY!
Not for human/animal use or any diagnostic or therapeutic purpose. Qualified personnel only.
$44
BeautyDermal is a Canadian company with warehouses all over the world. Most of the orders are being shipped from Europe. The shipping is free for all orders over $750. Otherwise, the shipping cost is $40. We work with the best carriers (FedEx, DHL, UPS, etc.) and will provide You with a tracking number as soon as we will receive it. The product is being shipped within the next 1-2 business days after the order was placed. The approximate delivery time is 3-5 business days. Read more
Unhappy with your order? Contact us upon receiving it for store credit, reshipment, or refund. Store credit: Available upon approval for future purchases. Reshipment: Replacement for lost/damaged items (3-5 business days). Refund: Full or partial order compensation (3-5 business days). Conditions: Products must be unopened, unused, and undamaged (except for faults). Refused Orders: No returns for refused deliveries (local post office, courier, border control, customs). Read more
We offer only original botulinum products and dermal fillers. Only medical professionals, doctors, dermatologists, plastic surgeons, and licensed aestheticians can place an order.
Found a better price on the same product from another supplier? Reach out to us, and we'll strive to match it! Read more
Brands

Strength

1 mg

Form

Lyophilized powder

Purity (%)

≥99

CAS number

946870-92-4

Chemical Formula

C₃₈₅H₆₂₅N₁₁₁O₁₁₅S₉

Molecular weight

9111–9112 g/mol

Synonyms

IGF-1 LR3, Long R3 IGF-1, Long Arg3 Insulin-Like Growth Factor

Peptide sequence

MFPAMPLSSLFVNGPRTLCGGELVDALQFVDNTPKTKTGIVDECCFRSCDLRRLEMYCAPLKPAKSAFPTTGGHVDSSRVPESKSRVTRR

Storage

Store at 2-8 °C. Protect from light and moisture

Shelf Life (lyophilized)

18-24 months

Shelf Life (after reconstitution)

7-28 days

Prices in Europe are almost two times lower than on the US market, in addition, we buy in bulk that’s why we can offer such affordable prices.

We offer wholesale prices which are displayed on our website for most of our products. If you’re interested in purchasing hundreds of one product please let us know by calling +1 647-696-5424

We offer significantly lower prices and guarantee that you will receive your order. If the package won’t reach you for some reason we will send you a new one for our cost.

We use the best shipping companies to deliver your products to you. The average delivery time is 3-5 business days.

You can pay using your credit card. We value our customers and offer them the most secure payment option.

MON – FRI: 10:00 AM – 06:00 PM EST.
Saturday – Sunday: holiday

We recommend these products