MON - FRI 10:00 AM - 06:00 PM EST.
SAT - SUN holiday
| Brands | |
|---|---|
| Strength | 1 mg |
| Form | Lyophilized powder |
| Purity (%) | ≥99 |
| CAS number | 946870-92-4 |
| Chemical Formula | C₃₈₅H₆₂₅N₁₁₁O₁₁₅S₉ |
| Molecular weight | 9111–9112 g/mol |
| Synonyms | IGF-1 LR3, Long R3 IGF-1, Long Arg3 Insulin-Like Growth Factor |
| Peptide sequence | MFPAMPLSSLFVNGPRTLCGGELVDALQFVDNTPKTKTGIVDECCFRSCDLRRLEMYCAPLKPAKSAFPTTGGHVDSSRVPESKSRVTRR |
| Storage | Store at 2-8 °C. Protect from light and moisture |
| Shelf Life (lyophilized) | 18-24 months |
| Shelf Life (after reconstitution) | 7-28 days |
| Shelf Life (unopened) | |
| Shelf Life (in use) |
Prices in Europe are almost two times lower than on the US market, in addition, we buy in bulk that’s why we can offer such affordable prices.
We offer wholesale prices which are displayed on our website for most of our products. If you’re interested in purchasing hundreds of one product please let us know by calling +1 647-696-5424
We offer significantly lower prices and guarantee that you will receive your order. If the package won’t reach you for some reason we will send you a new one for our cost.
We use the best shipping companies to deliver your products to you. The average delivery time is 3-5 business days.
You can pay using your credit card. We value our customers and offer them the most secure payment option.
MON – FRI: 10:00 AM – 06:00 PM EST.
Saturday – Sunday: holiday
- Generate your unique referral link and share it with your affiliates.
- Wait for your affiliates to verify their accounts and start placing orders.
- Receive an instant $500 credit once your first affiliate verifies their account and you together reach $2,000 in total orders.
- Earn 1% commission on the total value of orders placed by your affiliates.
- Use the referral link shared with you to join the program.
- Create your BeautyDermal account and complete verification (including license confirmation).
- Get a unique 5% discount on top of the wholesale price for your first order.
- Receive an instant $100 credit once you and your referrer together reach $2,000 in total orders.
















